PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr031538.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Nin-like
Protein Properties Length: 261aa    MW: 29573.9 Da    PI: 5.6954
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr031538.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.42.2e-26146193552
       RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++l++++kyF+ pi++AAkeL+v+lTvLKr+CR+++I+RWPhRkiksl
  Pbr031538.1 146 LELDEIQKYFDVPITQAAKELKVGLTVLKRRCRELNIMRWPHRKIKSL 193
                  7899******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.881124214IPR003035RWP-RK domain
PfamPF020429.6E-24146193IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MADSISSQLL FPKIETDPHE FNSSIHAAAL ESLHLENFNG FDSPPLPLGC KSNQLPQMGS  60
QDFEDSGIWD YILNDAAFPS PFGYEVVDEK PLTTMAESVD CSNSVSGDSD DVLRTIEWGM  120
KIWGKDEDES RTKNESCCKK RCGTPLELDE IQKYFDVPIT QAAKELKVGL TVLKRRCREL  180
NIMRWPHRKI KSLNALIENV KGMGLTNDVM MLEEHKRVLQ QMPDMELPER AKRLRQACFK  240
TNYKKKRALC LNALPVHDLV *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009357371.10.0PREDICTED: uncharacterized protein LOC103948099
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-42RWP-RK domain-containing protein